missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXA7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £484.00
Specifications
| Antigen | HOXA7 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18287584
|
Novus Biologicals
NBP2-55996 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18670959
|
Novus Biologicals
NBP2-55996-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HOXA7 Polyclonal specifically detects HOXA7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| HOXA7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ANTP, homeo box A7, homeobox A7, Homeobox protein Hox 1.1, Homeobox protein Hox-1A, homeobox protein Hox-A7, HOX1.1, HOX1AHOX1 | |
| HOXA7 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3204 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNALFSKYTAGTSLFQNAEPTSCSFAPNSQRSGYGA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title