missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HORMAD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HORMAD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HORMAD2 Polyclonal specifically detects HORMAD2 in Human samples. It is validated for Western Blot.Specifications
| HORMAD2 | |
| Polyclonal | |
| Rabbit | |
| Q8N7B1 | |
| 150280 | |
| Synthetic peptides corresponding to HORMAD2(HORMA domain containing 2) The peptide sequence was selected from the middle region of HORMAD2. Peptide sequence YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HORMA domain containing 2, HORMA domain-containing protein 2, MGC26710 | |
| HORMAD2 | |
| IgG | |
| 35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title