hnRNP-Q Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57197

Product Code. 18224954

Description

hnRNP-Q Polyclonal specifically detects hnRNP-Q in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: hnRNP-Q
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ3J17.2, Glycine- and tyrosine-rich RNA-binding protein, GRYRBP, GRY-RBPNS1-associated protein 1, heterogeneous nuclear ribonucleoprotein Q, hnRNP Q, hnRNP-Q, HNRPQ, HNRPQ1, NSAP1FLJ31626, PP68, synaptotagmin binding, cytoplasmic RNA interacting protein, Synaptotagmin-binding, cytoplasmic RNA-interacting protein
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10492
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O60506
• Gene Symbols: SYNCRIP
• Immunogen: Synthetic peptides corresponding to SYNCRIP(synaptotagmin binding, cytoplasmic RNA interacting protein) The peptide sequence was selected from the middle region of SYNCRIP. Peptide sequence IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only