hnRNP C1 + C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35893-100ul

Product Code. 30228970

Description

hnRNP C1 + C2 Polyclonal antibody specifically detects hnRNP C1 + C2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: hnRNP C1 + C2
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C1, C2, heterogeneous nuclear ribonucleoprotein C (C1/C2), heterogeneous nuclear ribonucleoproteins C1/C2, HNRNP, hnRNP C1/C2, hnRNPC, HNRPC, MGC104306, MGC105117, MGC117353, MGC131677, nuclear ribonucleoprotein particle C1 protein, nuclear ribonucleoprotein particle C2 protein, SNRPC
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 86-190 of human hnRNP C1 + C2 (NP_112604.2).,, Sequence:, AEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKG
• Quantity: 100 μL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 3183
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified