missing translation for 'onlineSavingsMsg'
Learn More
Learn More
hnRNP C1 + C2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35893-20ul
This item is not returnable.
View return policy
Description
hnRNP C1 + C2 Polyclonal antibody specifically detects hnRNP C1 + C2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| hnRNP C1 + C2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C1, C2, heterogeneous nuclear ribonucleoprotein C (C1/C2), heterogeneous nuclear ribonucleoproteins C1/C2, HNRNP, hnRNP C1/C2, hnRNPC, HNRPC, MGC104306, MGC105117, MGC117353, MGC131677, nuclear ribonucleoprotein particle C1 protein, nuclear ribonucleoprotein particle C2 protein, SNRPC | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 86-190 of human hnRNP C1 + C2 (NP_112604.2).,, Sequence:, AEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKG | |
| 20 μL | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| 3183 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction