missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HNF1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£171.00 - £401.00
Specifications
| Antigen | HNF1 |
|---|---|
| Dilution | ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231513
|
Novus Biologicals
NBP3-33333-100ul |
100 μL |
£401.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232246
|
Novus Biologicals
NBP3-33333-20ul |
20 μL |
£171.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HNF1 Monoclonal antibody specifically detects HNF1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)Specifications
| HNF1 | |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 6927 | |
| IgG | |
| Affinity purified |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| HNF1 homeobox A, IDDM20, LFB1transcription factor 1, hepatic; LF-B1, hepatic nuclear factor (HNF1), albuminproximal factor, MODY3, TCF1hepatic, Transcription factor 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human HNF1 (NP_000536.6).,, Sequence:, GEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title