missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HNF-4 gamma/NR2A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£386.00
Specifications
| Antigen | HNF-4 gamma/NR2A2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HNF-4 gamma/NR2A2 Polyclonal specifically detects HNF-4 gamma/NR2A2 in Human samples. It is validated for Western Blot.Specifications
| HNF-4 gamma/NR2A2 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| hepatocyte nuclear factor 4, gamma, hepatocyte nuclear factor 4-gamma, HNF-4-gamma, NR2A2Nuclear receptor subfamily 2 group A member 2, NR2A3 | |
| HNF4G | |
| IgG | |
| 46 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q14541 | |
| 3174 | |
| Synthetic peptides corresponding to HNF4G(hepatocyte nuclear factor 4, gamma) The peptide sequence was selected from the C terminal of HNF4G (NP_004124). Peptide sequence QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title