missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HMX2 Monoclonal antibody specifically detects HMX2 in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | HMX2 |
| Applications | ELISA, Immunocytochemistry |
| Classification | Monoclonal |
| Clone | 2D2 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_005510 |
| Gene Alias | H6 family homeobox 2, H6 homeo box 2, H6L, homeo box (H6 family) 2, homeobox (H6 family) 2, Homeobox protein H6 family member 2, homeobox protein HMX2, NKX5-2 |
| Host Species | Mouse |
| Immunogen | HMX2 (NP_005510, 125 a.a. ~ 224 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?