missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HMP19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49217
This item is not returnable.
View return policy
Description
HMP19 Polyclonal antibody specifically detects HMP19 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| HMP19 | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Hmp19, HMP19 protein, hypothalamus golgi apparatus expressed 19 kDa protein, neuron-specific protein family member 2, NSG2, p19 protein, Protein p19 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH | |
| 0.1 mL | |
| Signal Transduction | |
| 51617 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction