HMGCS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18443262	Novus Biologicals NBP2-33907-25ul	25 μL
18786163	Novus Biologicals NBP2-33907

Descrizione

HMGCS2 Polyclonal specifically detects HMGCS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifica

• Antigen: HMGCS2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial), EC 2.3.3.10, HMG-CoA synthase, hydroxymethylglutaryl-CoA synthase, mitochondrial, mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase
• Gene Symbols: HMGCS2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: P54868
• Gene ID (Entrez): 3158
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only