missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HMGB2 Rabbit anti-Human, Mouse, Rat, Clone: 8P10V5, Novus Biologicals™
Beskrivning
HMGB2 Monoclonal antibody specifically detects HMGB2 in Human, Mouse, Rat samples. It is validated for Western Blot, ChIP assay, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifikationer
Specifikationer
| Antigen | HMGB2 |
| Applications | ChIP Assay, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation |
| Classification | Monoclonal |
| Clone | 8P10V5 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | High mobility group protein 2, high mobility group protein B2, high-mobility group box 2, HMG-2, HMG2high-mobility group (nonhistone chromosomal) protein 2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGB2 (P26583). MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPS |
| Visa mer |
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?