missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HMGB2 Rabbit anti-Human, Mouse, Rat, Clone: 8P10V5, Novus Biologicals™
Description
HMGB2 Monoclonal antibody specifically detects HMGB2 in Human, Mouse, Rat samples. It is validated for Western Blot, ChIP assay, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | HMGB2 |
| Applications | ChIP Assay, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation |
| Classification | Monoclonal |
| Clone | 8P10V5 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | High mobility group protein 2, high mobility group protein B2, high-mobility group box 2, HMG-2, HMG2high-mobility group (nonhistone chromosomal) protein 2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGB2 (P26583). MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?