missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HMGA2 Monoclonal antibody specifically detects HMGA2 in Human samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | HMGA2 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Clone | 2D3 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_003474 |
| Gene Alias | BABLHMGI-C, high mobility group AT-hook 2, High mobility group AT-hook protein 2, high mobility group protein HMGI-C, high-mobility group (nonhistone chromosomal) protein isoform I-C, High-mobility group protein HMGI-C, HMGICSTQTL9, LIPO |
| Host Species | Mouse |
| Immunogen | HMGA2 (NP_003474, 1 a.a. ∽ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?