Invitrogen™ HMG4 Monoclonal Antibody (7G13)

Mouse Monoclonal Antibody

Brand:  Invitrogen™ MA536230

Product Code. 17196733

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human Hela whole cell, human T-47D whole cell, human A431 whole cell, human HepG2 whole cell, human Caco-2 whole cellhuman SW620 whole cellhuman Raji whole cell. IHC: human placenta tissue. ICC/IF: Hela cell. Flow: Hela cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription.

Specifications

• Antigen: HMG4
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O15347
• Gene Symbols: HMGB3
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 7G13
• Conjugate: Unconjugated
• Gene: HMGB3
• Gene Alias: high mobility group box 3; high mobility group protein 1; high mobility group protein 2a; High mobility group protein 4; high mobility group protein B1; high mobility group protein B3; high mobilty group protein 2A; high-mobility group (nonhistone chromosomal) protein 4; high-mobility group protein 4; HMG-1; HMG2a; HMG-2a; HMG4; HMG-4; HMGB1; Hmgb3; HMGB3 transcript variant 1/2; MGC90319; RGD1564407; Unknown (protein for MGC:133786)
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 3149
• Content And Storage: -20°C
• Form: Lyophilized