missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HMG2L1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
HMG2L1 Polyclonal antibody specifically detects HMG2L1 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | HMG2L1 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | High mobility group protein 2-like 1, high-mobility group protein 2-like 1, HMG box domain containing 4, HMG domain-containing protein 4, HMG2L1HMG box-containing protein 4, HMGBCG, Protein HMGBCG, THC211630 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPT |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?