missing translation for 'onlineSavingsMsg'
Learn More

HM74A/PUMA-G/GPR109A/NIACR1 Antibody, Novus Biologicals™

Product Code. p-200071117 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18422892 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18422892 Supplier Novus Biologicals Supplier No. NBP19218025ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 4 publications

HM74A/PUMA-G/GPR109A/NIACR1 Polyclonal specifically detects HM74A/PUMA-G/GPR109A/NIACR1 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HM74A/PUMA-G/GPR109A/NIACR1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot Reported in scientific literature (PMID 25622782)., Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated Reported in scientific publication (PMID: 32397071).
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8TDS4
Gene Alias GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1
Gene Symbols HCAR2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 338442
Test Specificity Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.