HM74A/PUMA-G/GPR109A/NIACR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Brand:  Novus Biologicals NBP1-92180-25ul

Product Code. 18422892

Description

HM74A/PUMA-G/GPR109A/NIACR1 Polyclonal specifically detects HM74A/PUMA-G/GPR109A/NIACR1 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Spécification

• Antigen: HM74A/PUMA-G/GPR109A/NIACR1
• Classification: Polyclonal
• Dilution: Western Blot Reported in scientific literature (PMID 25622782)., Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated Reported in scientific publication (PMID: 32397071).
• Gene Accession No.: Q8TDS4
• Gene Symbols: HCAR2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 338442
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only