missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HLRC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

HLRC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18399332 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18399332 100 μg 100µL
18347925 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18399332 Supplier Novus Biologicals Supplier No. NBP317381100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

HLRC1 Polyclonal antibody specifically detects HLRC1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen HLRC1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Deoxyhypusine dioxygenase, deoxyhypusine hydroxylase, deoxyhypusine hydroxylase/monooxygenase, Deoxyhypusine monooxygenase, EC 1.14.99.29, hDOHH, HEAT-like (PBS lyase) repeat containing 1, HEAT-like repeat-containing protein 1, HLRC1, MGC4293
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: TENPMVRHECAEALGAIAQPACLAALQAHADDPERVVRESCEVALDMYEHETG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 83475
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.