missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18371488

HLA DRB4 Antibody, Novus Biologicals™

Product Code. 18371488 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18371488 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18371488 Supplier Novus Biologicals Supplier No. H00003126B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

HLA DRB4 Polyclonal antibody specifically detects HLA DRB4 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen HLA DRB4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_068818.4
Gene Alias class II histocompatibility antigen HLA DR alpha, beta1-0307, DR12, DR-12, DR13, DR-13, DR14, DR-14, DR4, DR-4, DRB1 transplantation antigen, DRB4, HLA class II histocompatibility antigen, DR beta 4 chain, HLA class II histocompatibility antigen, DRB1-12 beta chain, HLA class II histocompatibility antigen, DRB1-4 beta chain, HLA-DR4B, human leucocyte antigen DRB4, leucocyte antigen DRB1, leukocyte antigen, major histocompatibility complex, class II, DR beta 1, major histocompatibility complex, class II, DR beta 4, MHC class I antigen DRB1*12, MHC class I antigen DRB1*4, MHC class II antigen DRB1*12, MHC class II antigen DRB1*13, MHC class II antigen DRB1*14, MHC class II antigen DRB1*4, MHC class II antigen DRB4, MHC class II antigen HLA-DRB1, MHC class II antigen HLA-DR-beta, MHC class II HLA-DR-beta-7, MHC class2 antigen, MHC HLA DR-beta chain
Host Species Mouse
Immunogen HLA-DRB4 (NP_068818.4, 1 a.a. - 266 a.a.) full-length human protein. MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Purification Method Protein G purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Asthma, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3126
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.