missing translation for 'onlineSavingsMsg'
Learn More

HLA DRB1 Antibody, Novus Biologicals™

Product Code. 18354468 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18354468 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18354468 Supplier Novus Biologicals Supplier No. H00003123B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

HLA DRB1 Polyclonal antibody specifically detects HLA DRB1 in Human samples. It is validated for Western Blot, Flow Cytometry, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen HLA DRB1
Applications Western Blot, Flow Cytometry, ELISA
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH33827.1
Gene Alias Clone P2-beta-3, DR1, DR-1, DR12, DR-12, DR13, DR-13, DR14, DR-14, DR16, DR-16, DR4, DR-4, DR5, DR-5, DR7, DR-7, DR8, DR-8, DR9, DR-9, DRB1, DRw10, DRw11, DRw8, DW2.2/DR2.2, FLJ75017, FLJ76359, HLA class II antigen beta chain, HLA class II histocompatibility antigen, DR-1 beta chain, HLA-DR1B, HLA-DRB, HLA-DRB1*, HLA-DRB2, HLA-DR-beta 1, human leucocyte antigen DRB1, leucocyte antigen DR beta 1 chain, leucocyte antigen DRB1, lymphocyte antigen DRB1, major histocompatibility complex, class II, DR beta 1, MHC class II antigen DRB1*1, MHC class II antigen DRB1*10, MHC class II antigen DRB1*11, MHC class II antigen DRB1*12, MHC class II antigen DRB1*13, MHC class II antigen DRB1*14, MHC class II antigen DRB1*15, MHC class II antigen DRB1*16, MHC class II antigen DRB1*3, MHC class II antigen DRB1*4, MHC class II antigen DRB1*7, MHC class II antigen DRB1*8, MHC class II antigen DRB1*9, MHC class II antigen HLA-DR13, MHC class II HLA-DR
Host Species Mouse
Immunogen HLA-DRB1 (AAH33827.1, 1 a.a. - 266 a.a.) full-length human protein. MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Asthma, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3123
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.