missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HLA DMB Polyclonal antibody specifically detects HLA DMB in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | HLA DMB |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | class II histocompatibility antigen, M beta chain, D6S221E, DMB, major histocompatibility complex, class II, DM beta, MHC class II antigen DMB, MHC class II antigen HLA-DM beta chain, MHC class II HLA-DMB, Really interesting new gene 7 protein, RING7HLA class II histocompatibility antigen, DM beta chain |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?