missing translation for 'onlineSavingsMsg'
Learn More

HLA C Antibody, Novus Biologicals™

Product Code. 18391648 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18391648 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18391648 Supplier Novus Biologicals Supplier No. H00003107B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

HLA C Polyclonal antibody specifically detects HLA C in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen HLA C
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH02463
Gene Alias C alpha chain, D6S204, FLJ27082, HLA class I histocompatibility antigen, Cw-1 alpha chain, HLAC, HLA-Cw, HLA-JY3, HLC-C, human leukocyte antigen-C alpha chain, leucocyte antigen C, leucocyte antigen Cw, leukocyte antigen-C alpha chain, major histocompatibility antigen HLA-C, major histocompatibility complex, class I, C, MHC class I antigen Cw*1, MHC class I antigen Cw*12, MHC class I antigen Cw*14, MHC class I antigen Cw*15, MHC class I antigen Cw*16, MHC class I antigen Cw*17, MHC class I antigen Cw*2, MHC class I antigen Cw*3, MHC class I antigen Cw*4, MHC class I antigen Cw*5, MHC class I antigen Cw*6, MHC class I antigen Cw*7, MHC class I antigen Cw*8, MHC class I antigen heavy chain HLA-C, PSORS1
Host Species Mouse
Immunogen HLA-C (AAH02463, 1 a.a. - 366 a.a.) full-length human protein. MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Adaptive Immunity, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3107
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.