missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35753-100ul
This item is not returnable.
View return policy
Description
HLA A Polyclonal antibody specifically detects HLA A in Human samples. It is validated for ELISA,Western Blot
Specifications
| HLA A | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| A-10 alpha chain, FLJ26655, HLA class I histocompatibility antigen, A-1 alpha chain, HLA class I histocompatibility antigen, A-28 alpha chain, HLA class I histocompatibility antigen, A-9 alpha chain, HLAA, major histocompatibility complex, class I, A, MHC class I antigen A*1, MHC class I antigen A*11, MHC class I antigen A*80 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA A (NP_002107.3).,, Sequence:, GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL | |
| 100 μL | |
| Adaptive Immunity, Cell Biology, Immunology | |
| 3105 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction