missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HKDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35683-100ul
This item is not returnable.
View return policy
Description
HKDC1 Polyclonal antibody specifically detects HKDC1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| HKDC1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EC 2.7.1, EC 2.7.1.1, FLJ22761, FLJ37767, hexokinase domain containing 1, Hexokinase domain-containing protein 1, MGC125688, putative hexokinase HKDC1 | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HKDC1 (NP_079406.3).,, Sequence:, LGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEG | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 80201 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction