missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | HIV-1 Gag p24 |
| Applications | Western Blot, ELISA |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 750 |
| Formulation | 50mM Sodium Borate |
| Host Species | Rabbit |
| Immunogen | Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla |
| Purification Method | Peptide affinity purified |
| Quantity | 0.1 mL |
| Regulatory Status | RUO |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?