missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Histatin 1 Polyclonal antibody specifically detects Histatin 1 in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | Histatin 1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Formulation | PBS (pH 7.4) |
| Gene Accession No. | NP_002150.1 |
| Gene Alias | HIS1Histidine-rich protein 1, histatin 1, histatin-1, Post-PB protein, PPB |
| Host Species | Mouse |
| Immunogen | HTN1 (NP_002150.1, 1 a.a. - 57 a.a.) full-length human protein. MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?