HISPPD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38368-25ul

Product Code. 18670736

Description

HISPPD1 Polyclonal specifically detects HISPPD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HISPPD1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: O43314
• Gene Symbols: PPIP5K2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKGCEEDKNLPSGYGYRPASRENEGRRPFKIDNDDEPHTSKRDEVDRAVILFKPMVSEPIHIHRKSPLPRSRKTATND
• Quantity: 25 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 23262
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: diphosphoinositol pentakisphosphate kinase 2FLJ21506, EC 2.7.4.21, EC 2.7.4.24, HISPPD1histidine acid phosphatase domain containing 1, Histidine acid phosphatase domain-containing protein 1, hsVIP2, inositol heptaphosphate kinase 2, inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2, InsP6 and PP-IP5 kinase 2, KIAA0433FLJ23463, VIP1 homolog 2, VIP2IP7K2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.