missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HIPPI Polyclonal antibody specifically detects HIPPI in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | HIPPI |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | Dermal papilla-derived protein 8, DERP8, ESRRBL1huntingtin interacting protein-1 interacting protein, estrogen-related receptor beta like 1, Estrogen-related receptor beta-like protein 1, FLJ10147, HIPPIHIP1-interacting protein, intraflagellar transport 57 homolog (Chlamydomonas), intraflagellar transport protein 57 homolog, MHS4R2HIP1 protein interactor |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPN |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?