missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIPK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HIPK4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HIPK4 Polyclonal specifically detects HIPK4 in Human samples. It is validated for Western Blot.Specifications
| HIPK4 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| EC 2.7.11.1, FLJ32818, homeodomain interacting protein kinase 4, homeodomain-interacting protein kinase 4 | |
| HIPK4 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NE63 | |
| 147746 | |
| Synthetic peptides corresponding to HIPK4(homeodomain interacting protein kinase 4) The peptide sequence was selected from the middle region of HIPK4. Peptide sequence AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title