missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18385409

HIPK2 Antibody (1D8), Novus Biologicals™

Product Code. 18385409 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18385409 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18385409 Supplier Novus Biologicals Supplier No. H00028996M08

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

HIPK2 Monoclonal antibody specifically detects HIPK2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen HIPK2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1D8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_073577
Gene Alias DKFZp686K02111, EC 2.7.11.1, FLJ23711, hHIPk2, homeodomain interacting protein kinase 2, homeodomain-interacting protein kinase 2, PRO0593
Host Species Mouse
Immunogen HIPK2 (NP_073577.2, 213 a.a. ~ 293 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSTSATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQAL IVCPPGFQGLQASPSKHAGYS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 28996
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.