HIP-55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91988

Product Code. 18017106

Description

HIP-55 Polyclonal specifically detects HIP-55 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HIP-55
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: ABP1, Cervical SH3P7, CMAP, Drebrin-F, drebrin-like, drebrin-like protein, HIP-55SH3P7Cervical mucin-associated protein, HPK1-interacting protein of 55 kDa, SH3 domain-containing protein 7, src homology 3 domain-containing protein HIP-55
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DBNL
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 28988
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only