missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIF-2 alpha/EPAS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £375.00
Specifications
| Antigen | HIF-2 alpha/EPAS1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18220593
|
Novus Biologicals
NBP2-58653 |
100 μL |
£375.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605247
|
Novus Biologicals
NBP2-58653-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HIF-2 alpha/EPAS1 Polyclonal specifically detects HIF-2 alpha/EPAS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| HIF-2 alpha/EPAS1 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Apoptosis, Cancer, Cancer Stem Cells, Chromatin Research, Embryonic Stem Cell Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Transcription Factors and Regulators | |
| Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, Class E basic helix-loop-helix protein 73, ECYT4, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS1, EPAS-1, HIF-1-alpha-like factor, HIF-1alpha-like factor, HIF-2 alpha, | |
| EPAS1 | |
| IgG | |
| Affinity Purified | |
| 96.5 kDa |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 2034 | |
| This HIF-2 alpha/EPAS1 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG | |
| Primary | |
| The specificity of this HIF-2 alpha/EPAS1 Antibody was verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title