missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIC5/TGFB1I1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10300-100UL
This item is not returnable.
View return policy
Description
HIC5/TGFB1I1 Polyclonal specifically detects HIC5/TGFB1I1 in Human samples. It is validated for Western Blot, Immunohistochemistry.
Specifications
| HIC5/TGFB1I1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Androgen receptor coactivator 55 kDa protein, androgen receptor coactivator ARA55, Androgen receptor-associated protein of 55 kDa, ARA55Hydrogen peroxide-inducible clone 5 protein, HIC5, HIC-5, transforming growth factor beta 1 induced transcript 1, transforming growth factor beta-1-induced transcript 1 protein, TSC-5 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human HIC5/TGFB1I1 (NP_057011). Peptide sequence PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR | |
| 100 μg | |
| Cell Cycle and Replication | |
| 7041 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction