missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ HIC1 Antibody (1F2), Novus Biologicals™

Product Code. 18343808 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18343808 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18343808 Supplier Novus Biologicals™ Supplier No. H00003090M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

HIC1 Monoclonal antibody specifically detects HIC1 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen HIC1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1F2
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006488
Gene Alias hic-1, hypermethylated in cancer 1, ZBTB29hypermethylated in cancer 1 protein, Zinc finger and BTB domain-containing protein 29, ZNF901
Host Species Mouse
Immunogen HIC1 (NP_006488.2, 627 a.a. ∽ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 3090
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.