missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HIC1 Monoclonal antibody specifically detects HIC1 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | HIC1 |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Clone | 1F2 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_006488 |
| Gene Alias | hic-1, hypermethylated in cancer 1, ZBTB29hypermethylated in cancer 1 protein, Zinc finger and BTB domain-containing protein 29, ZNF901 |
| Host Species | Mouse |
| Immunogen | HIC1 (NP_006488.2, 627 a.a. ∽ 705 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?