missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HHLA3 Monoclonal antibody specifically detects HHLA3 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
Specifications
Specifications
| Antigen | HHLA3 |
| Applications | Western Blot, ELISA, Immunocytochemistry, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 1F6 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | HERV-H LTR-associating 3, HERV-H LTR-associating protein 3, human endogenous retrovirus-H long terminal repeat-associating 3, Human endogenous retrovirus-H long terminal repeat-associating protein 3 |
| Host Species | Mouse |
| Immunogen | HHLA3 (NP_009002, 1 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAV |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?