missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HGD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55134
This item is not returnable.
View return policy
Description
HGD Polyclonal specifically detects HGD in Human samples. It is validated for Western Blot.
Specifications
| HGD | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| AKU, EC 1.13.11.5, HGOFLJ94126, homogentisate 1,2-dioxygenase, homogentisate 1,2-dioxygenase (homogentisate oxidase), homogentisate oxidase, Homogentisate oxygenase, Homogentisic acid oxidase, homogentisicase | |
| Rabbit | |
| 50 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q93099 | |
| HGD | |
| Synthetic peptides corresponding to HGD(homogentisate 1,2-dioxygenase (homogentisate oxidase)) The peptide sequence was selected from the middle region of HGD. Peptide sequence KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL. | |
| Affinity purified | |
| RUO | |
| 3081 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction