missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ HGD Antibody (3G4), Novus Biologicals™

Product Code. 18343988 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18343988 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18343988 Supplier Novus Biologicals™ Supplier No. H00003081M10

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

HGD Monoclonal antibody specifically detects HGD in Human samples. It is validated for ELISA,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen HGD
Applications ELISA, Sandwich ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 3G4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000178
Gene Alias AKU, EC 1.13.11.5, HGOFLJ94126, homogentisate 1,2-dioxygenase, homogentisate 1,2-dioxygenase (homogentisate oxidase), homogentisate oxidase, Homogentisate oxygenase, Homogentisic acid oxidase, homogentisicase
Host Species Mouse
Immunogen HGD (NP_000178, 377 a.a. ∽ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3081
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.