missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HFM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81954
This item is not returnable.
View return policy
Description
HFM1 Polyclonal antibody specifically detects HFM1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| HFM1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| FLJ39011, helicase-like protein HFM1, HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae), probable ATP-dependent DNA helicase HFM1, RP11-539G11.1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCK | |
| 0.1 mL | |
| Cell Biology | |
| 164045 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction