missing translation for 'onlineSavingsMsg'
Learn More

Hey L Antibody (3D3), Novus Biologicals™

Product Code. 18388589 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18388589 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18388589 Supplier Novus Biologicals Supplier No. H00026508M12

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Hey L Monoclonal antibody specifically detects Hey L in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Hey L
Applications Western Blot, ELISA
Classification Monoclonal
Clone 3D3
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055386
Gene Alias BHLHB33, bHLHb33hHeyL, Class B basic helix-loop-helix protein 33, hairy/enhancer-of-split related with YRPW motif 3, hairy/enhancer-of-split related with YRPW motif-like, hairy/enhancer-of-split related with YRPW motif-like protein, Hairy-related transcription factor 3, HEY3, HEY-like protein, hHRT3, HRT3, HRT-3, MGC12623
Host Species Mouse
Immunogen HEYL (NP_055386, 1 a.a. ~ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 26508
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.