HEXO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57118

Product Code. 18274845

Description

HEXO Polyclonal specifically detects HEXO in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HEXO
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3' exoribonuclease, 3'-5' exonuclease ERI1, 3'EXO, 3'HEXO, EC 3.1, enhanced RNAi three prime mRNA exonuclease homolog 1, Eri-1 homolog, exoribonuclease 1, HEXO, histone mRNA 3' end-specific exonuclease, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, MGC35395, Protein 3'hExo, THEX1, three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1, three prime mRNA exonuclease 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90459
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IV48
• Gene Symbols: ERI1
• Immunogen: Synthetic peptides corresponding to THEX1(three prime histone mRNA exonuclease 1) The peptide sequence was selected from the N terminal of THEX1. Peptide sequence SKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKD The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG