HEXIM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18485251	Novus Biologicals NBP1-93876-25ul	25 μL
18045857	Novus Biologicals NBP1-93876	0.1 mL

Description

HEXIM2 Polyclonal specifically detects HEXIM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HEXIM2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 124790
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: FLJ32384, hexamethylene bis-acetamide inducible 2, hexamethylene bis-acetamide-inducible protein 2, hexamethylene-bis-acetamide-inducible transcript 2, hexamthylene bis-acetamide inducible 2, L3, MAQ1 paralog, protein HEXIM2
• Gene Symbols: HEXIM2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only