HEXB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48689

Product Code. 18685698

Description

HEXB Polyclonal antibody specifically detects HEXB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: HEXB
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: beta-hexosaminidase subunit beta, Beta-N-acetylhexosaminidase subunit beta, Cervical cancer proto-oncogene 7 protein, EC 3.2.1.52, ENC-1AS, HCC-7, hexosaminidase B (beta polypeptide), Hexosaminidase subunit B, N-acetyl-beta-glucosaminidase subunit beta
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYI
• Quantity: 0.1 mL
• Research Discipline: Neurodegeneration
• Gene ID (Entrez): 3074
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified