missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18358889

HES2 Antibody (4H6), Novus Biologicals™

Product Code. 18358889 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358889 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18358889 Supplier Novus Biologicals Supplier No. H00054626M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

HES2 Monoclonal antibody specifically detects HES2 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ChIP assay (ChIP)
TRUSTED_SUSTAINABILITY

Specifications

Antigen HES2
Applications Western Blot, ELISA, Immunocytochemistry, ChIP Assay
Classification Monoclonal
Clone 4H6
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_061962
Gene Alias BHLHB40, bHLHb40Class B basic helix-loop-helix protein 40, Hairy and enhancer of split 2, hairy and enhancer of split 2 (Drosophila), transcription factor HES-2
Host Species Mouse
Immunogen HES2 (NP_061962, 41 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 54626
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.