missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HES-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68846-25ul
This item is not returnable.
View return policy
Description
HES-1 Polyclonal antibody specifically detects HES-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| HES-1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| BHLHB39, bHLHb39hairy homolog (Drosophila), Class B basic helix-loop-helix protein 39, FLJ20408, Hairy and enhancer of split 1, hairy and enhancer of split 1, (Drosophila), Hairy homolog, Hairy-like protein, Hes1, HES-1, hHL, HL, HRYHHL, transcription factor HES-1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG | |
| 25 μL | |
| Stem Cell Markers | |
| 3280 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction