HES-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68846

Product Code. 18660369

Description

HES-1 Polyclonal antibody specifically detects HES-1 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: HES-1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: BHLHB39, bHLHb39hairy homolog (Drosophila), Class B basic helix-loop-helix protein 39, FLJ20408, Hairy and enhancer of split 1, hairy and enhancer of split 1, (Drosophila), Hairy homolog, Hairy-like protein, Hes1, HES-1, hHL, HL, HRYHHL, transcription factor HES-1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSG
• Quantity: 100 μg
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 3280
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified