missing translation for 'onlineSavingsMsg'
Learn More

Hepcidin Antimicrobial Peptide Antibody (1F9), Novus Biologicals™

Product Code. 18427169 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18427169 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18427169 Supplier Novus Biologicals Supplier No. H00057817M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Hepcidin Antimicrobial Peptide Monoclonal antibody specifically detects Hepcidin Antimicrobial Peptide in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Hepcidin Antimicrobial Peptide
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 1F9
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH20612
Gene Alias hepcidin antimicrobial peptide, HEPCPutative liver tumor regressor, HFE2Bhepcidin, LEAP-1, LEAP1PLTR, Liver-expressed antimicrobial peptide 1
Host Species Mouse
Immunogen HAMP (AAH20612, 25 a.a. ∽ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57817
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.