missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HepaCAM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HepaCAM |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HepaCAM Polyclonal specifically detects HepaCAM in Human samples. It is validated for Western Blot.Specifications
| HepaCAM | |
| Polyclonal | |
| Rabbit | |
| Q14CZ8 | |
| 220296 | |
| Synthetic peptides corresponding to HEPACAM(hepatocyte cell adhesion molecule) The peptide sequence was selected from the N terminal of HEPACAM. Peptide sequence LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cancer susceptibility, FLJ25530, glial cell adhesion molecule, GLIALCAM, hepaCAM, hepatic and glial cell adhesion molecule, hepatocyte cell adhesion molecule, Protein hepaCAM | |
| HEPACAM | |
| IgG | |
| 46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title