missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18378707

Hemoglobin zeta Antibody (1G10), Novus Biologicals™

Product Code. 18378707 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18378707 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18378707 Supplier Novus Biologicals Supplier No. H00003050M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Hemoglobin zeta Monoclonal antibody specifically detects Hemoglobin zeta in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Hemoglobin zeta
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 1G10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005323
Gene Alias HBAZ, HBZ2, hemoglobin subunit zeta, Hemoglobin zeta chain, hemoglobin, zeta, zeta-globin
Host Species Mouse
Immunogen HBZ (NP_005323, 1 a.a. ~ 81 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3050
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.