Hemoglobin A1 Rabbit anti-Human, Mouse, Rat, Clone: 1R1N7, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-16804-20UL

Product Code. 18331905

Description

Hemoglobin A1 Monoclonal antibody specifically detects Hemoglobin A1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Hemoglobin A1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: 1R1N7
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: alpha one globin, alpha-1 globin, alpha-1-globin, alpha-globin, CD31, hemoglobin alpha 1 globin chain, Hemoglobin alpha chain, hemoglobin alpha-1 chain, hemoglobin subunit alpha, hemoglobin, alpha 1, MGC126895, MGC126897
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hemoglobin A1 (HBA1) (P69905). MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFK
• Quantity: 20 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 3039
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG