missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HEM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HEM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HEM1 Polyclonal specifically detects HEM1 in Human samples. It is validated for Western Blot.Specifications
| HEM1 | |
| Polyclonal | |
| Rabbit | |
| NP_005328 | |
| 3071 | |
| Synthetic peptide directed towards the N terminal of human NCKAP1L. Peptide sequence CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Hematopoietic protein 1HEM1Membrane-associated protein HEM-1, NCK-associated protein 1-like | |
| NCKAP1L | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title